Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine LAP3 protein

This Bovine LAP3 protein spans the amino acid sequence from region 25-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LAP3

UniProt

P00727

Expression Region

25-64aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PGPAAADMTKGLVLGIYSKEKEEDEPQFTSAGENFNKLVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL38 Antibody, HRP conjugated
CSB-PA02405B0Rb-01 50 µg

RPL38 Antibody, HRP conjugated

Sign In for Pricing
View Details
RPL38 Antibody, HRP conjugated
CSB-PA02405B0Rb-02 100 µg

RPL38 Antibody, HRP conjugated

Sign In for Pricing
View Details
EDF1 (NM_001281299) Human Tagged ORF Clone
RC235885 10 µg

EDF1 (NM_001281299) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse PCSK7 siRNA
abx928009-01 15 nmol

Mouse PCSK7 siRNA

Sign In for Pricing
View Details
Mouse PCSK7 siRNA
abx928009-02 30 nmol

Mouse PCSK7 siRNA

Sign In for Pricing
View Details
IL18R1 3'UTR Lenti-reporter-Luc Vector
24838081 1.0 µg

IL18R1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details