Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human STK11 protein

This Human STK11 protein spans the amino acid sequence from region 1-430aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

STK11

UniProt

Q15831

Expression Region

1-430aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSAC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK6 Antibody
orb684763 100 µL

CDK6 Antibody

Sign In for Pricing
View Details
RBM4 Antibody - middle region
ARP40426_P050-25UL 25 µL

RBM4 Antibody - middle region

Sign In for Pricing
View Details
Rabbit Coiled-coil domain-containing protein 147 (CCDC147) ELISA Kit
MBS7221384-01 48 Well

Rabbit Coiled-coil domain-containing protein 147 (CCDC147) ELISA Kit

Sign In for Pricing
View Details
Rabbit Coiled-coil domain-containing protein 147 (CCDC147) ELISA Kit
MBS7221384-02 96 Well

Rabbit Coiled-coil domain-containing protein 147 (CCDC147) ELISA Kit

Sign In for Pricing
View Details
Rabbit Coiled-coil domain-containing protein 147 (CCDC147) ELISA Kit
MBS7221384-03 5x 96 Well

Rabbit Coiled-coil domain-containing protein 147 (CCDC147) ELISA Kit

Sign In for Pricing
View Details
Rabbit Coiled-coil domain-containing protein 147 (CCDC147) ELISA Kit
MBS7221384-04 10x 96 Well

Rabbit Coiled-coil domain-containing protein 147 (CCDC147) ELISA Kit

Sign In for Pricing
View Details