Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human STK11 protein

This Human STK11 protein spans the amino acid sequence from region 1-430aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

STK11

UniProt

Q15831

Expression Region

1-430aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSAC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Smyd5 shRNA (UAS) - Lentiviral mouse Smyd5 shRNA (UAS, GFP) (100)
GTR15289725 1 Vial

Lentiviral mouse Smyd5 shRNA (UAS) - Lentiviral mouse Smyd5 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
3-Amino-6- (4-fluoro-phenyl) -pyridine-2-carboxylic acid amide
PC109634 1 g

3-Amino-6- (4-fluoro-phenyl) -pyridine-2-carboxylic acid amide

Sign In for Pricing
View Details
OR13D3P Protein Vector (Human) (pPB-N-His)
PV106163 500 ng

OR13D3P Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Vom1r31 (NM_001008969) Rat Untagged Clone
RN208093 10 µg

Vom1r31 (NM_001008969) Rat Untagged Clone

Sign In for Pricing
View Details
CD10 (FR4D11), CF647 conjugate, 0.1mg/mL
BNC470248-100 1x 100 µL

CD10 (FR4D11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DPPA4 Polyclonal Antibody
E11-202082 100 µg -100 µL

DPPA4 Polyclonal Antibody

Sign In for Pricing
View Details