Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HIST1H2AG protein

This Human HIST1H2AG protein spans the amino acid sequence from region 2-130aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HIST1H2AG

UniProt

P0C0S8

Expression Region

2-130aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 2-130aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldo-Keto Reductase (ARKs) Activity Assay Kit
E-BC-K810-M 96 T (40 samples)

Aldo-Keto Reductase (ARKs) Activity Assay Kit

Sign In for Pricing
View Details
DMC1 (2H12/4), CF594 conjugate, 0.1mg/mL
BNC942178-100 1x 100 µL

DMC1 (2H12/4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tide Quencher™ 5.1WS acid [TQ5.1WS acid]
2073-AAT 5 mg

Tide Quencher™ 5.1WS acid [TQ5.1WS acid]

Sign In for Pricing
View Details
Automated Solid Phase Extraction System BSPE-203
BSPE-203 Each

Automated Solid Phase Extraction System BSPE-203

Sign In for Pricing
View Details
DNAJB4 Antibody
8C12333-AAT 50 µg

DNAJB4 Antibody

Sign In for Pricing
View Details
PE Anti-Mouse IL-17A Antibody[17F3]
E-AB-F1272D-01 50 Tests

PE Anti-Mouse IL-17A Antibody[17F3]

Sign In for Pricing
View Details