Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CRMP1 protein

This Human CRMP1 protein spans the amino acid sequence from region 1-572aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CRMP1

UniProt

Q14194

Expression Region

1-572aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

78.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cholinergic Receptor, Nicotinic Alpha 5 (CHRNA5) Antibody
abx145762-01 100 µg

Cholinergic Receptor, Nicotinic Alpha 5 (CHRNA5) Antibody

Sign In for Pricing
View Details
Cholinergic Receptor, Nicotinic Alpha 5 (CHRNA5) Antibody
abx145762-02 1 mg

Cholinergic Receptor, Nicotinic Alpha 5 (CHRNA5) Antibody

Sign In for Pricing
View Details
Cytomegalovirus (CMV-IE1/2) discontinued. see 375945
470594 500 µg

Cytomegalovirus (CMV-IE1/2) discontinued. see 375945

Sign In for Pricing
View Details
C3orf59 Peptide - C-terminal region
MBS3236228-01 0.1 mg

C3orf59 Peptide - C-terminal region

Sign In for Pricing
View Details
C3orf59 Peptide - C-terminal region
MBS3236228-02 5x 0.1 mg

C3orf59 Peptide - C-terminal region

Sign In for Pricing
View Details
Cnidii Fructus Extract
C15053-25mg 25 mg

Cnidii Fructus Extract

Sign In for Pricing
View Details