Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MFAP5 protein

This Human MFAP5 protein spans the amino acid sequence from region 22-173aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MFAP5

UniProt

Q13361

Expression Region

22-173aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IgA Protein
ARO-P15743 100 µg

Recombinant Mouse IgA Protein

Sign In for Pricing
View Details
Epiplakin (HRP)
315040-01 50 µg

Epiplakin (HRP)

Sign In for Pricing
View Details
Epiplakin (HRP)
315040-02 100 µg

Epiplakin (HRP)

Sign In for Pricing
View Details
Hsa-miR-3651 miRNA Antagomir
orb1915189-01 10 nmol

Hsa-miR-3651 miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-3651 miRNA Antagomir
orb1915189-02 20 nmol

Hsa-miR-3651 miRNA Antagomir

Sign In for Pricing
View Details
Recombinant Carnitine Palmitoyltransferase 1A, Liver (CPT1A)
TRV-0010295-01 10 µg

Recombinant Carnitine Palmitoyltransferase 1A, Liver (CPT1A)

Sign In for Pricing
View Details