Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MFAP5 protein

This Human MFAP5 protein spans the amino acid sequence from region 22-173aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MFAP5

UniProt

Q13361

Expression Region

22-173aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CycloneSpin Digital Magnetic Stirrer Hotplate TT-DMSH-350S, 80-1800rpm, R.T. +5 (min. 30°C)-340°C, 137mm plate diameter, AC110V
TT-DMSH-350S-110V 1 Unit

CycloneSpin Digital Magnetic Stirrer Hotplate TT-DMSH-350S, 80-1800rpm, R.T. +5 (min. 30°C)-340°C, 137mm plate diameter, AC110V

Sign In for Pricing
View Details
Simian Virus 5 (PIV5) (MaxLight 650)
MBS6256334-01 0.1 mL

Simian Virus 5 (PIV5) (MaxLight 650)

Sign In for Pricing
View Details
Simian Virus 5 (PIV5) (MaxLight 650)
MBS6256334-02 5x 0.1 mL

Simian Virus 5 (PIV5) (MaxLight 650)

Sign In for Pricing
View Details
C1ql1 3'UTR Luciferase Stable Cell Line
TU102934 1.0 mL

C1ql1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-PBX1 Antibody
A01039-3 100 µL

Anti-PBX1 Antibody

Sign In for Pricing
View Details
PRLD2 Rabbit Polyclonal Antibody
JOT-AP12194-01 20 µL

PRLD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details