Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MFAP5 protein

This Human MFAP5 protein spans the amino acid sequence from region 22-173aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MFAP5

UniProt

Q13361

Expression Region

22-173aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ELL2 Antibody
A06309 100 µL

Anti-ELL2 Antibody

Sign In for Pricing
View Details
Mmu-miR-3088-5p miRNA Inhibitor
CIM0761-01 10 nmol

Mmu-miR-3088-5p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-3088-5p miRNA Inhibitor
CIM0761-02 20 nmol

Mmu-miR-3088-5p miRNA Inhibitor

Sign In for Pricing
View Details
Human LRP8 ELISA Kit
E023012 1 Each

Human LRP8 ELISA Kit

Sign In for Pricing
View Details
SPERT Antibody, FITC conjugated
MBS1498094-01 0.05 mg

SPERT Antibody, FITC conjugated

Sign In for Pricing
View Details
SPERT Antibody, FITC conjugated
MBS1498094-02 0.1 mg

SPERT Antibody, FITC conjugated

Sign In for Pricing
View Details