Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HDAC3 protein

This Human HDAC3 protein spans the amino acid sequence from region 1-428aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HDAC3

UniProt

O15379

Expression Region

1-428aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-428aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Shroom3 ORF Vector (Rat) (pORF)
ORF076230 1.0 µg DNA

Shroom3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Human Uncharacterized protein KIAA0040, KIAA0040 ELISA KIT
ELI-13635h 96 Tests

Human Uncharacterized protein KIAA0040, KIAA0040 ELISA KIT

Sign In for Pricing
View Details
Culture Medium for Immortalized Human Cartilage Cells
AFG-ELL-2863-01 100 mL

Culture Medium for Immortalized Human Cartilage Cells

Sign In for Pricing
View Details
Culture Medium for Immortalized Human Cartilage Cells
AFG-ELL-2863-02 500 mL

Culture Medium for Immortalized Human Cartilage Cells

Sign In for Pricing
View Details
Goat Atrial natriuretic peptide receptor 1 (NPR1) ELISA kit
GTR10416613 96 Well

Goat Atrial natriuretic peptide receptor 1 (NPR1) ELISA kit

Sign In for Pricing
View Details
ENAH CRISPR Knock Out 293T Cell Line (Human)
19280141 1x 10^6 Cells / 1.0 mL

ENAH CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details