Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2R1 protein

This Human PLA2R1 protein spans the amino acid sequence from region 395-530aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PLA2R1

UniProt

Q13018

Expression Region

395-530aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F1353UH-01 25 µg

PE/Cyanine7 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F1353UH-02 100 µg

PE/Cyanine7 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
Bromo Polystyrene
H40009.100G 100 g

Bromo Polystyrene

Sign In for Pricing
View Details
Recombinant Mouse CD28/TP44 Protein (Fc & His Tag)
PKSM041241-01 10 µg

Recombinant Mouse CD28/TP44 Protein (Fc & His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD28/TP44 Protein (Fc & His Tag)
PKSM041241-02 50 µg

Recombinant Mouse CD28/TP44 Protein (Fc & His Tag)

Sign In for Pricing
View Details
APC Anti-Mouse CD206/MMR Antibody[C068C2]
E-AB-F1135E-01 50 Tests

APC Anti-Mouse CD206/MMR Antibody[C068C2]

Sign In for Pricing
View Details