Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2R1 protein

This Human PLA2R1 protein spans the amino acid sequence from region 395-530aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PLA2R1

UniProt

Q13018

Expression Region

395-530aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL-5 protein (His Tag)
PKSM041461-01 20 µg

Recombinant Mouse IL-5 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-5 protein (His Tag)
PKSM041461-02 100 µg

Recombinant Mouse IL-5 protein (His Tag)

Sign In for Pricing
View Details
Fibronectin (2755-8), 1mg/mL
BNUM0091-50 1x 50 µL

Fibronectin (2755-8), 1mg/mL

Sign In for Pricing
View Details
Melanoma Antigen Family A, 4 / MAGEA4 (CPTC-MAGEA4-1), CF488A conjugate, 0.1mg/mL
BNC882246-100 1x 100 µL

Melanoma Antigen Family A, 4 / MAGEA4 (CPTC-MAGEA4-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/3772R), CF405S conjugate, 0.1mg/mL
BNC043772-100 1x 100 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/3772R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (WT1/857), CF647 conjugate, 0.1mg/mL
BNC470857-100 1x 100 µL

WT1 (Wilm's Tumor 1) (WT1/857), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details