Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2R1 protein

This Human PLA2R1 protein spans the amino acid sequence from region 395-530aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PLA2R1

UniProt

Q13018

Expression Region

395-530aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJB2 Knockout HAP1 Polyclonal Cells
ARG39116 1 Million

DNAJB2 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
Ncor2 3'UTR GFP Stable Cell Line
TU163901 1.0 mL

Ncor2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Porcine Spectrin Alpha Chain, Erythrocytic 1 (SPTA1) ELISA Kit
MBS9924624-01 48 Well

Porcine Spectrin Alpha Chain, Erythrocytic 1 (SPTA1) ELISA Kit

Sign In for Pricing
View Details
Porcine Spectrin Alpha Chain, Erythrocytic 1 (SPTA1) ELISA Kit
MBS9924624-02 96 Well

Porcine Spectrin Alpha Chain, Erythrocytic 1 (SPTA1) ELISA Kit

Sign In for Pricing
View Details
Porcine Spectrin Alpha Chain, Erythrocytic 1 (SPTA1) ELISA Kit
MBS9924624-03 5x 96 Well

Porcine Spectrin Alpha Chain, Erythrocytic 1 (SPTA1) ELISA Kit

Sign In for Pricing
View Details
Porcine Spectrin Alpha Chain, Erythrocytic 1 (SPTA1) ELISA Kit
MBS9924624-04 10x 96 Well

Porcine Spectrin Alpha Chain, Erythrocytic 1 (SPTA1) ELISA Kit

Sign In for Pricing
View Details