Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GYPA GPA protein

This Human GYPA GPA protein spans the amino acid sequence from region 20-91aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GYPA GPA

UniProt

A0A0C4DFT7

Expression Region

20-91aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular domain of GST-tag and expression region is 20-91aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (C4/206), CF405M conjugate, 0.1mg/mL
BNC050206-500 1x 500 µL

CD4 (C4/206), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS634296 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
LY75 Antibody
KC-7469-01 50 μL

LY75 Antibody

Sign In for Pricing
View Details
LY75 Antibody
KC-7469-02 100 µL

LY75 Antibody

Sign In for Pricing
View Details
LY75 Antibody
KC-7469-03 1 mL

LY75 Antibody

Sign In for Pricing
View Details
Recombinant Human Vasorin/VASN Protein (His Tag)
PKSH033206-01 10 µg

Recombinant Human Vasorin/VASN Protein (His Tag)

Sign In for Pricing
View Details