Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GYPA GPA protein

This Human GYPA GPA protein spans the amino acid sequence from region 20-91aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GYPA GPA

UniProt

A0A0C4DFT7

Expression Region

20-91aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular domain of GST-tag and expression region is 20-91aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCM (RNMT) (NM_003799) Human Recombinant Protein
TP307787L 1 mg

HCM (RNMT) (NM_003799) Human Recombinant Protein

Sign In for Pricing
View Details
B4GALT1 (NM_001497) Human Over-expression Lysate
LY400575 100 µg

B4GALT1 (NM_001497) Human Over-expression Lysate

Sign In for Pricing
View Details
HOPX (C-term) Rabbit Polyclonal Antibody
AP52072PU-N 400 µL

HOPX (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD31 Polyclonal Antibody
E-AB-12617-01 20 µL

CD31 Polyclonal Antibody

Sign In for Pricing
View Details
CD31 Polyclonal Antibody
E-AB-12617-02 60 µL

CD31 Polyclonal Antibody

Sign In for Pricing
View Details
CD31 Polyclonal Antibody
E-AB-12617-03 120 µL

CD31 Polyclonal Antibody

Sign In for Pricing
View Details