Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GYPA GPA protein

This Human GYPA GPA protein spans the amino acid sequence from region 20-91aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GYPA GPA

UniProt

A0A0C4DFT7

Expression Region

20-91aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular domain of GST-tag and expression region is 20-91aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® S CHO
S30136.25G 25 g

TentaGel® S CHO

Sign In for Pricing
View Details
Sodium Benzoate-d5
TRC-S614001-10MG 10 mg

Sodium Benzoate-d5

Sign In for Pricing
View Details
CD1a (O10 + C1A/711), Biotin conjugate, 0.1mg/mL
BNCB0717-100 1x 100 µL

CD1a (O10 + C1A/711), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ICAM1 Rabbit Monoclonal Antibody [Clone ID: R09-7A9]
TA384477 100 µL

ICAM1 Rabbit Monoclonal Antibody [Clone ID: R09-7A9]

Sign In for Pricing
View Details
Recombinant Rat S100B protein (His tag)
PDER100165-01 20 µg

Recombinant Rat S100B protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat S100B protein (His tag)
PDER100165-02 100 µg

Recombinant Rat S100B protein (His tag)

Sign In for Pricing
View Details