Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Guca2b protein

This Mouse Guca2b protein spans the amino acid sequence from region 22-106aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Guca2b

UniProt

O09051

Expression Region

22-106aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 22-106aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELNE Polyclonal Antibody
MBS8531290-01 0.1 mg

ELNE Polyclonal Antibody

Sign In for Pricing
View Details
ELNE Polyclonal Antibody
MBS8531290-02 0.1 mL (AF635)

ELNE Polyclonal Antibody

Sign In for Pricing
View Details
ELNE Polyclonal Antibody
MBS8531290-03 0.1 mL (AF610)

ELNE Polyclonal Antibody

Sign In for Pricing
View Details
ELNE Polyclonal Antibody
MBS8531290-04 0.1 mL (AF405S)

ELNE Polyclonal Antibody

Sign In for Pricing
View Details
ELNE Polyclonal Antibody
MBS8531290-05 0.1 mL (AF405L)

ELNE Polyclonal Antibody

Sign In for Pricing
View Details
ELNE Polyclonal Antibody
MBS8531290-06 0.1 mL (AF546)

ELNE Polyclonal Antibody

Sign In for Pricing
View Details