Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RBBP7 protein

This Human RBBP7 protein spans the amino acid sequence from region 1-425aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RBBP7

UniProt

Q16576

Expression Region

1-425aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

63.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD221/IGF1R Antibody (SAA0072), PE
FHC29912 100 Tests

Anti-Human CD221/IGF1R Antibody (SAA0072), PE

Sign In for Pricing
View Details
1-chloro-4-propoxythioxanthen-9-one
JH141451 1 Each

1-chloro-4-propoxythioxanthen-9-one

Sign In for Pricing
View Details
Lentiviral mouse Avil shRNA (UAS) - Lentiviral mouse Avil shRNA (UAS, iRFP) (25)
GTR15221630 1 Vial

Lentiviral mouse Avil shRNA (UAS) - Lentiviral mouse Avil shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Recombinant Burkholderia phytofirmans Chaperone protein DnaJ (dnaJ)
MBS1004532-01 0.02 mg (E-Coli)

Recombinant Burkholderia phytofirmans Chaperone protein DnaJ (dnaJ)

Sign In for Pricing
View Details
Recombinant Burkholderia phytofirmans Chaperone protein DnaJ (dnaJ)
MBS1004532-02 0.02 mg (Yeast)

Recombinant Burkholderia phytofirmans Chaperone protein DnaJ (dnaJ)

Sign In for Pricing
View Details
Recombinant Burkholderia phytofirmans Chaperone protein DnaJ (dnaJ)
MBS1004532-03 0.1 mg (E-Coli)

Recombinant Burkholderia phytofirmans Chaperone protein DnaJ (dnaJ)

Sign In for Pricing
View Details