Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RBBP7 protein

This Human RBBP7 protein spans the amino acid sequence from region 1-425aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RBBP7

UniProt

Q16576

Expression Region

1-425aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

63.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIMM Protein Vector (Human) (pPB-N-His)
PV090879 500 ng

LIMM Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Optineurin Recombinant Rabbit mAb
orb2322613-01 25 µL

Optineurin Recombinant Rabbit mAb

Sign In for Pricing
View Details
Optineurin Recombinant Rabbit mAb
orb2322613-02 50 µL

Optineurin Recombinant Rabbit mAb

Sign In for Pricing
View Details
Optineurin Recombinant Rabbit mAb
orb2322613-03 100 µL

Optineurin Recombinant Rabbit mAb

Sign In for Pricing
View Details
DHHC-9 Polyclonal Antibody
MBS8592138-01 0.1 mg

DHHC-9 Polyclonal Antibody

Sign In for Pricing
View Details
DHHC-9 Polyclonal Antibody
MBS8592138-02 0.1 mL (AF405L)

DHHC-9 Polyclonal Antibody

Sign In for Pricing
View Details