Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GTF2H5 protein

This Human GTF2H5 protein spans the amino acid sequence from region 1-71aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GTF2H5

UniProt

Q6ZYL4

Expression Region

1-71aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-71aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

JAK3 Antibody - middle region : HRP (ARP54306_P050-HRP)
ARP54306_P050-HRP 100 µL

JAK3 Antibody - middle region : HRP (ARP54306_P050-HRP)

Sign In for Pricing
View Details
Insulin Degrading Enzyme Mouse Antibody
orb2626489 100 µL

Insulin Degrading Enzyme Mouse Antibody

Sign In for Pricing
View Details
TIPIN Antibody
C50656-01 40 µL

TIPIN Antibody

Sign In for Pricing
View Details
TIPIN Antibody
C50656-02 100 µL

TIPIN Antibody

Sign In for Pricing
View Details
TIPIN Antibody
C50656-03 200 µL

TIPIN Antibody

Sign In for Pricing
View Details
Rabbit Fibroblast growth factor 21,FGF21 ELISA Kit
ELA-E0188Rb 96 Tests

Rabbit Fibroblast growth factor 21,FGF21 ELISA Kit

Sign In for Pricing
View Details