Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GTF2H5 protein

This Human GTF2H5 protein spans the amino acid sequence from region 1-71aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GTF2H5

UniProt

Q6ZYL4

Expression Region

1-71aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-71aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lemalesomab (Reference antibody)
E55B0362 100 µg

Lemalesomab (Reference antibody)

Sign In for Pricing
View Details
Rabbit Polyclonal TBRG4 Antibody [DyLight 350]
NBP2-98536UV 0.1 mL

Rabbit Polyclonal TBRG4 Antibody [DyLight 350]

Sign In for Pricing
View Details
FANCL sgRNA CRISPR Lentivector set (Human)
K0757301 3x 1.0 µg

FANCL sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Lewis a Trisaccharide
sc-203104 2 mg

Lewis a Trisaccharide

Sign In for Pricing
View Details
E/E074/NT-PP-100X100/1 Safety & Regulatory Compliance Signs (No Adhesive)
320219 1 Pack (1 Panel (s) x 1 Pack)

E/E074/NT-PP-100X100/1 Safety & Regulatory Compliance Signs (No Adhesive)

Sign In for Pricing
View Details
Protein FAM106B (FAM106B) Human ELISA Kit
G2794 96 Tests

Protein FAM106B (FAM106B) Human ELISA Kit

Sign In for Pricing
View Details