Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UGP2 protein

This Human UGP2 protein spans the amino acid sequence from region 1-497aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UGP2

UniProt

Q16851

Expression Region

1-497aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

71.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Anti-CD68 Rabbit mAb
MBS8326302-01 0.03 mL

Recombinant Anti-CD68 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-CD68 Rabbit mAb
MBS8326302-02 0.05 mL

Recombinant Anti-CD68 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-CD68 Rabbit mAb
MBS8326302-03 0.1 mL

Recombinant Anti-CD68 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-CD68 Rabbit mAb
MBS8326302-04 0.2 mL

Recombinant Anti-CD68 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-CD68 Rabbit mAb
MBS8326302-05 5x 0.2 mL

Recombinant Anti-CD68 Rabbit mAb

Sign In for Pricing
View Details
Human recombinant CD6 protein
PROTP30203-100ug 100 µg

Human recombinant CD6 protein

Sign In for Pricing
View Details