Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UGP2 protein

This Human UGP2 protein spans the amino acid sequence from region 1-497aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UGP2

UniProt

Q16851

Expression Region

1-497aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

71.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Foxm1 3'UTR Luciferase Stable Cell Line
TU106697 1.0 mL

Foxm1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human Growth differentiation factor 11 (GDF-11)
BL10075_R 0.01 mg

Recombinant Human Growth differentiation factor 11 (GDF-11)

Sign In for Pricing
View Details
ERBIN Rabbit Polyclonal Antibody
JOT-AP09696-01 20 µL

ERBIN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERBIN Rabbit Polyclonal Antibody
JOT-AP09696-02 50 μL

ERBIN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERBIN Rabbit Polyclonal Antibody
JOT-AP09696-03 100 µL

ERBIN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ANKRD23 (NM_144994) Human Over-expression Lysate
LS200539-100ug 100 µg

ANKRD23 (NM_144994) Human Over-expression Lysate

Sign In for Pricing
View Details