Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UGP2 protein

This Human UGP2 protein spans the amino acid sequence from region 1-497aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UGP2

UniProt

Q16851

Expression Region

1-497aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

71.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP5 (Bone Morphogenetic Protein 5, MGC34244) (MaxLight 750) discontinued
243818-ML750 100 µL

BMP5 (Bone Morphogenetic Protein 5, MGC34244) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Lentiviral human FGFR4 shRNA (UAS) - Lentiviral human FGFR4 shRNA (UAS, GFP) (25)
GTR15317003 1 Vial

Lentiviral human FGFR4 shRNA (UAS) - Lentiviral human FGFR4 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Lentiviral human MDK shRNA (UAS) - Lentiviral human MDK shRNA (UAS, GFP) (100)
GTR15115233 1 Vial

Lentiviral human MDK shRNA (UAS) - Lentiviral human MDK shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Murashige and Skoog Modified Basal Salt Mixture (Powder) discontinued
299708-01 50 L

Murashige and Skoog Modified Basal Salt Mixture (Powder) discontinued

Sign In for Pricing
View Details
Murashige and Skoog Modified Basal Salt Mixture (Powder) discontinued
299708-02 100 L

Murashige and Skoog Modified Basal Salt Mixture (Powder) discontinued

Sign In for Pricing
View Details
Cefamandole nafate
S3638-25mg 25 mg

Cefamandole nafate

Sign In for Pricing
View Details