Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human POU2AF1 protein

This Human POU2AF1 protein spans the amino acid sequence from region 1-256aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

POU2AF1

UniProt

Q16633

Expression Region

1-256aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Kv4.3/KCND3 Antibody Picoband® (Biotine Conjugate)
PB9229-Biotin 100 µg/Vial

Anti-Kv4.3/KCND3 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
TULP1 (Tubby-related Protein 1)
494905 100 µL

TULP1 (Tubby-related Protein 1)

Sign In for Pricing
View Details
Phospho-INPP5D-Y1020 pAb
MBS9135631-01 0.02 mL

Phospho-INPP5D-Y1020 pAb

Sign In for Pricing
View Details
Phospho-INPP5D-Y1020 pAb
MBS9135631-02 0.1 mL

Phospho-INPP5D-Y1020 pAb

Sign In for Pricing
View Details
Phospho-INPP5D-Y1020 pAb
MBS9135631-03 5x 0.1 mL

Phospho-INPP5D-Y1020 pAb

Sign In for Pricing
View Details
RNF11 (RING Finger Protein 11, CGI-123) (MaxLight 490)
MBS6202988-01 0.1 mL

RNF11 (RING Finger Protein 11, CGI-123) (MaxLight 490)

Sign In for Pricing
View Details