Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GLRX protein

This Human GLRX protein spans the amino acid sequence from region 1-106aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GLRX GRX

UniProt

P35754

Expression Region

1-106aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-106aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REMBRANDT® CEP1-ISH probe mix biotin
C701P.0100.05 5 Assays

REMBRANDT® CEP1-ISH probe mix biotin

Sign In for Pricing
View Details
Rabbit Polyclonal VASA Antibody
NBP2-95280-100ul 100 µL

Rabbit Polyclonal VASA Antibody

Sign In for Pricing
View Details
ACTL6A, NT (ACTL6A, BAF53, BAF53A, INO80K, Actin-like protein 6A, 53kD BRG1-associated factor A, Actin-related protein Baf53a, ArpNbeta, BRG1-associated factor 53A, INO80 complex subunit K)
MBS6000574-01 0.2 mL

ACTL6A, NT (ACTL6A, BAF53, BAF53A, INO80K, Actin-like protein 6A, 53kD BRG1-associated factor A, Actin-related protein Baf53a, ArpNbeta, BRG1-associated factor 53A, INO80 complex subunit K)

Sign In for Pricing
View Details
ACTL6A, NT (ACTL6A, BAF53, BAF53A, INO80K, Actin-like protein 6A, 53kD BRG1-associated factor A, Actin-related protein Baf53a, ArpNbeta, BRG1-associated factor 53A, INO80 complex subunit K)
MBS6000574-02 5x 0.2 mL

ACTL6A, NT (ACTL6A, BAF53, BAF53A, INO80K, Actin-like protein 6A, 53kD BRG1-associated factor A, Actin-related protein Baf53a, ArpNbeta, BRG1-associated factor 53A, INO80 complex subunit K)

Sign In for Pricing
View Details
KRTAP23-1 Rabbit Polyclonal Antibody (HRP)
orb2117438 100 µL

KRTAP23-1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
5-HT-2C Antibody
34151-01 50 µL

5-HT-2C Antibody

Sign In for Pricing
View Details