Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GLRX protein

This Human GLRX protein spans the amino acid sequence from region 1-106aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GLRX GRX

UniProt

P35754

Expression Region

1-106aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-106aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1G2 Polyclonal Antibody, APC Conjugated
bs-10930R-APC 100 µL

ATP6V1G2 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
pGreenPuro Scramble Hairpin Control - Construct (EF1)
SI506-000PA-1 10 µg

pGreenPuro Scramble Hairpin Control - Construct (EF1)

Sign In for Pricing
View Details
TEA domain family member 2 (TEAD2) (NM_001256662) Human Untagged Clone
SC330477 10 µg

TEA domain family member 2 (TEAD2) (NM_001256662) Human Untagged Clone

Sign In for Pricing
View Details
CCR7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV649621 1.0 µg DNA

CCR7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human TNFRSF19/TROY ELISA Kit PicoKine®
EK1584 96 Well With Removable Strips

Human TNFRSF19/TROY ELISA Kit PicoKine®

Sign In for Pricing
View Details
Human HLA-DRA/DRB4 Antibody
E55A14279 100 µg

Human HLA-DRA/DRB4 Antibody

Sign In for Pricing
View Details