Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GLIPR1 protein

This Human GLIPR1 protein spans the amino acid sequence from region 22-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GLIPR1, GLIPR, RTVP1

UniProt

P48060

Expression Region

22-232aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 22-266aa of His-tag and expression region is 22-232aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse TREX1 Protein, N-His
orb3055415-01 50 µg

Recombinant Mouse TREX1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse TREX1 Protein, N-His
orb3055415-02 100 µg

Recombinant Mouse TREX1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse TREX1 Protein, N-His
orb3055415-03 1 mg

Recombinant Mouse TREX1 Protein, N-His

Sign In for Pricing
View Details
rHu Follistatin
AK9971-1000 1mg

rHu Follistatin

Sign In for Pricing
View Details
Poly (ethylene glycol) dimethacrylate (MW 1000)
orb3026568-01 250 mg

Poly (ethylene glycol) dimethacrylate (MW 1000)

Sign In for Pricing
View Details
Poly (ethylene glycol) dimethacrylate (MW 1000)
orb3026568-02 50 mg

Poly (ethylene glycol) dimethacrylate (MW 1000)

Sign In for Pricing
View Details