Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli cry1Fb protein

This E.coli cry1Fb protein spans the amino acid sequence from region 984-1169aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cry1Fb

UniProt

O66377

Expression Region

984-1169aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Bacillus thuringiensis subsp. morrisoni

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARG1 Antibody, HRP conjugated
MBS7051750-01 0.05 mg

ARG1 Antibody, HRP conjugated

Sign In for Pricing
View Details
ARG1 Antibody, HRP conjugated
MBS7051750-02 0.1 mg

ARG1 Antibody, HRP conjugated

Sign In for Pricing
View Details
ARG1 Antibody, HRP conjugated
MBS7051750-03 5x 0.1 mg

ARG1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Lentiviral human FUZ shRNA (UAS) - Lentiviral human FUZ shRNA (UAS, GFP) (100)
GTR15101481 1 Vial

Lentiviral human FUZ shRNA (UAS) - Lentiviral human FUZ shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
IOLILYTE LBE 02 (56) 0-75
LBE-02 (56) 0-75-HP-BULK 1 Each

IOLILYTE LBE 02 (56) 0-75

Sign In for Pricing
View Details
Monoclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)
MBS2025685-01 0.1 mL

Monoclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)

Sign In for Pricing
View Details