Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli dsbA protein

This E.coli dsbA protein spans the amino acid sequence from region 23-214aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DsbA

UniProt

O52376

Expression Region

23-214aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Pseudomonas syringae pv. tomato (strain DC3000)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEPIESGKQYVELTSAVPVAVPGKIEVIELFWYGCPHCYAFEPTINPWVEKLPSDVNFVRIPAMFGGPWDAHGQLFITLDTMGVEHKVHAAVFEAIQKGGKRLTDKNDMADFVATQGVNKDDFLKTFDSFAVKGKIAQYKELAKKYEVTGVPTMIVNGKYRFDLGSAGGPEKTLQVADQLIDKERAAAKAAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Olfactory receptor 7D2 (OR7D2) ELISA Kit
MBS7229501-01 48 Well

Human Olfactory receptor 7D2 (OR7D2) ELISA Kit

Sign In for Pricing
View Details
Human Olfactory receptor 7D2 (OR7D2) ELISA Kit
MBS7229501-02 96 Well

Human Olfactory receptor 7D2 (OR7D2) ELISA Kit

Sign In for Pricing
View Details
Human Olfactory receptor 7D2 (OR7D2) ELISA Kit
MBS7229501-03 5x 96 Well

Human Olfactory receptor 7D2 (OR7D2) ELISA Kit

Sign In for Pricing
View Details
Human Olfactory receptor 7D2 (OR7D2) ELISA Kit
MBS7229501-04 10x 96 Well

Human Olfactory receptor 7D2 (OR7D2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti Human PUS1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot) 120ul
IRBAHUPUS1AP598120UL 120 µL

Rabbit Anti Human PUS1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot) 120ul

Sign In for Pricing
View Details
NLK 3'UTR Lenti-reporter-Luc Vector
31901081 1.0 µg

NLK 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details