Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli dsbA protein

This E.coli dsbA protein spans the amino acid sequence from region 23-214aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DsbA

UniProt

O52376

Expression Region

23-214aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Pseudomonas syringae pv. tomato (strain DC3000)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEPIESGKQYVELTSAVPVAVPGKIEVIELFWYGCPHCYAFEPTINPWVEKLPSDVNFVRIPAMFGGPWDAHGQLFITLDTMGVEHKVHAAVFEAIQKGGKRLTDKNDMADFVATQGVNKDDFLKTFDSFAVKGKIAQYKELAKKYEVTGVPTMIVNGKYRFDLGSAGGPEKTLQVADQLIDKERAAAKAAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Serine/arginine-Rich Splicing Factor 1
32-4957-20 20 µg

Recombinant Human Serine/arginine-Rich Splicing Factor 1

Sign In for Pricing
View Details
Porcine Carcinoembryonic Antigen (CEA) ELISA Kit
MBS266778-01 48 Well

Porcine Carcinoembryonic Antigen (CEA) ELISA Kit

Sign In for Pricing
View Details
Porcine Carcinoembryonic Antigen (CEA) ELISA Kit
MBS266778-02 96 Well

Porcine Carcinoembryonic Antigen (CEA) ELISA Kit

Sign In for Pricing
View Details
Porcine Carcinoembryonic Antigen (CEA) ELISA Kit
MBS266778-03 5x 96 Well

Porcine Carcinoembryonic Antigen (CEA) ELISA Kit

Sign In for Pricing
View Details
Porcine Carcinoembryonic Antigen (CEA) ELISA Kit
MBS266778-04 10x 96 Well

Porcine Carcinoembryonic Antigen (CEA) ELISA Kit

Sign In for Pricing
View Details
GADD45A (Growth Arrest And DNA-damage-inducible Protein GADD45 alpha, DNA-damage-inducible Transcript 1, DDIT-1, DDIT1, GADD45) (MaxLight 405) discontinued
127093-ML405 100 µL

GADD45A (Growth Arrest And DNA-damage-inducible Protein GADD45 alpha, DNA-damage-inducible Transcript 1, DDIT-1, DDIT1, GADD45) (MaxLight 405) discontinued

Sign In for Pricing
View Details