Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli ORF3 protein

This E.coli ORF3 protein spans the amino acid sequence from region 1-114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ORF3

UniProt

O90299

Expression Region

1-114aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGSRPWALGLFCCCSSCFCLCCSRHRPVSRLAAVVGGAAAVPAVVSGVTGLILSPSQSPIFIQPTPSPRMSPLRPGLDLVFANPSDHSAPLGATRPSAPPLPHVVDLPQLGPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-UBR2 Picoband® Antibody-FITC Conjugate
A05812-2-FITC 100 µg/Vial

Anti-UBR2 Picoband® Antibody-FITC Conjugate

Sign In for Pricing
View Details
PREP Polyclonal Antibody
RA28999-01 50 µL

PREP Polyclonal Antibody

Sign In for Pricing
View Details
PREP Polyclonal Antibody
RA28999-02 100 µL

PREP Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Anti-Human CD8 alpha mAb (PE/Cy7)
orb2710567 100 Tests

Mouse Anti-Human CD8 alpha mAb (PE/Cy7)

Sign In for Pricing
View Details
Calicin (CCIN) Bovine ELISA Kit
C0660 96 Tests

Calicin (CCIN) Bovine ELISA Kit

Sign In for Pricing
View Details
RPL17P27 ORF Vector (Human) (pORF)
ORF030088 1.0 µg DNA

RPL17P27 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details