Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli ORF3 protein

This E.coli ORF3 protein spans the amino acid sequence from region 1-114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ORF3

UniProt

O90299

Expression Region

1-114aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGSRPWALGLFCCCSSCFCLCCSRHRPVSRLAAVVGGAAAVPAVVSGVTGLILSPSQSPIFIQPTPSPRMSPLRPGLDLVFANPSDHSAPLGATRPSAPPLPHVVDLPQLGPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECEL1 Protein Vector (Mouse) (pPM-C-His)
PV174313 500 ng

ECEL1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Next to BRCA1 gene 1 protein (NBR1) ELISA Kit
AE31631MO-01 48 Tests

Mouse Next to BRCA1 gene 1 protein (NBR1) ELISA Kit

Sign In for Pricing
View Details
Mouse Next to BRCA1 gene 1 protein (NBR1) ELISA Kit
AE31631MO-02 96 Tests

Mouse Next to BRCA1 gene 1 protein (NBR1) ELISA Kit

Sign In for Pricing
View Details
BATF
CSB-CL619074HU 10 μg Plasmid + 200 μL Glycerol

BATF

Sign In for Pricing
View Details
Anti-UT-B/SLC14A1 Antibody Picoband® (Dylight488 Conjugate)
A04926-2-Dylight488 100 µg

Anti-UT-B/SLC14A1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Spry4 ORF Vector (Mouse) (pORF)
ORF058431 1.0 µg DNA

Spry4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details