Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GDNF protein

This Human GDNF protein spans the amino acid sequence from region 78-211aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GDNF

UniProt

P39905

Expression Region

78-211aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 78-211aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Schizosaccharomyces pombe Probable ubiquitin carboxyl-terminal hydrolase 1 (ubp1), partial
MBS1331138 Inquire

Recombinant Schizosaccharomyces pombe Probable ubiquitin carboxyl-terminal hydrolase 1 (ubp1), partial

Sign In for Pricing
View Details
Tmem216 Mouse shRNA Lentiviral Particle (Locus ID 68642)
TL504184V 500 µL Each

Tmem216 Mouse shRNA Lentiviral Particle (Locus ID 68642)

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS500496 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Aiolos Rabbit mAb
F0874-100uL*2 2x 100 μL

Aiolos Rabbit mAb

Sign In for Pricing
View Details
5-[ ({[ (9H-Fluoren-9-yl) methoxy]carbonyl}amino) methyl]thieno[3,2-b]thiophene-2-carboxylic acid
AVD27103-01 50 mg

5-[ ({[ (9H-Fluoren-9-yl) methoxy]carbonyl}amino) methyl]thieno[3,2-b]thiophene-2-carboxylic acid

Sign In for Pricing
View Details
5-[ ({[ (9H-Fluoren-9-yl) methoxy]carbonyl}amino) methyl]thieno[3,2-b]thiophene-2-carboxylic acid
AVD27103-02 0.5 g

5-[ ({[ (9H-Fluoren-9-yl) methoxy]carbonyl}amino) methyl]thieno[3,2-b]thiophene-2-carboxylic acid

Sign In for Pricing
View Details