Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GDNF protein

This Human GDNF protein spans the amino acid sequence from region 78-211aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GDNF

UniProt

P39905

Expression Region

78-211aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 78-211aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMDAR2A (GRIN2A) (NM_000833) Human Tagged ORF Clone Lentiviral Particle
RC223136L2V 200 µL

NMDAR2A (GRIN2A) (NM_000833) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Gag-Pol antibody (FITC)
60R-2279 100 ug

Gag-Pol antibody (FITC)

Sign In for Pricing
View Details
SUPER-X PLEX ® Human Chemokine MULTI-PLEX Panel (6-Plex)
HMX370T 32 Tests

SUPER-X PLEX ® Human Chemokine MULTI-PLEX Panel (6-Plex)

Sign In for Pricing
View Details
Cluster of Differentiation 79B (CD79B) Polyclonal Antibody
CAU26034-01 100 µL

Cluster of Differentiation 79B (CD79B) Polyclonal Antibody

Sign In for Pricing
View Details
Cluster of Differentiation 79B (CD79B) Polyclonal Antibody
CAU26034-02 200 µL

Cluster of Differentiation 79B (CD79B) Polyclonal Antibody

Sign In for Pricing
View Details
Cluster of Differentiation 79B (CD79B) Polyclonal Antibody
CAU26034-03 1 mL

Cluster of Differentiation 79B (CD79B) Polyclonal Antibody

Sign In for Pricing
View Details