Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Gdf5 protein

This Mouse Gdf5 protein spans the amino acid sequence from region 376-495aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gdf5 Bp Gdf-5

UniProt

P43027

Expression Region

376-495aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 376-495aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPE Polyclonal Antibody
JOT-AP02179-01 50ul

CPE Polyclonal Antibody

Sign In for Pricing
View Details
CPE Polyclonal Antibody
JOT-AP02179-02 100ul

CPE Polyclonal Antibody

Sign In for Pricing
View Details
KIFC1 Protein Vector (Rat) (pPM-C-HA)
25698026 500 ng

KIFC1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
SPEG Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV667930 1.0 µg DNA

SPEG Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
EEF1D Knockout Hela Polyclonal Cells
ARG40560 1 Million

EEF1D Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Guinea Pig Ankyrin repeat domain containing protein 29 (ANKRD29) ELISA Kit
GTR10360436 96 Well

Guinea Pig Ankyrin repeat domain containing protein 29 (ANKRD29) ELISA Kit

Sign In for Pricing
View Details