Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Gdf5 protein

This Mouse Gdf5 protein spans the amino acid sequence from region 376-495aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gdf5 Bp Gdf-5

UniProt

P43027

Expression Region

376-495aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 376-495aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

His-tag Antibody
E38PA9059 100 µL

His-tag Antibody

Sign In for Pricing
View Details
Selenium Binding Protein 1 Rabbit Polyclonal Antibody (Cy5.5)
orb1043668 100 µL

Selenium Binding Protein 1 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Anti-KAP1 (Recombinant Rabbit, Monoclonal, IgG)
A115213 100 µL

Anti-KAP1 (Recombinant Rabbit, Monoclonal, IgG)

Sign In for Pricing
View Details
AMY1C Protein Vector (Human) (pPB-C-His)
PV062081 500 ng

AMY1C Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
FOXR1 Double Nickase Plasmid (m2)
sc-436368-NIC-2 20 µg

FOXR1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
ViPrimePLUS Nipah virus RT-qPCR Test Kit
VECN008 1 Kit

ViPrimePLUS Nipah virus RT-qPCR Test Kit

Sign In for Pricing
View Details