Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Gdf5 protein

This Mouse Gdf5 protein spans the amino acid sequence from region 376-495aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gdf5 Bp Gdf-5

UniProt

P43027

Expression Region

376-495aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 376-495aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(N-Morpholino)ethanesulfonic Acid-d13
M723776 10 mg

2-(N-Morpholino)ethanesulfonic Acid-d13

Sign In for Pricing
View Details
ZNF558 Antibody - N-terminal region : HRP (ARP34865_P050-HRP)
ARP34865_P050-HRP 100 µL

ZNF558 Antibody - N-terminal region : HRP (ARP34865_P050-HRP)

Sign In for Pricing
View Details
Cerium (III) Oxalate 99.9%
RE0395 100 g

Cerium (III) Oxalate 99.9%

Sign In for Pricing
View Details
CT47A6 (NM_001080141) Human Tagged Lenti ORF Clone
RC223845L4 10 µg

CT47A6 (NM_001080141) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MCM7 Peptide
orb2019020 100 µg

MCM7 Peptide

Sign In for Pricing
View Details
KBTBD11 Protein Lysate (Rat) with C-HA Tag
25312036 100 µg

KBTBD11 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details