Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli MRJP1 protein

This E.coli MRJP1 protein spans the amino acid sequence from region 20-432aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MRJP1

UniProt

O18330

Expression Region

20-432aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Apis mellifera (Honeybee)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCENPDNDRTPFKISIHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGALS3 (Carbohydrate-binding Protein 35, CBP35, GAL3, GALBP, GALIG, LGALS2, MAC2, Galectin 3) (PE)
MBS6424647-01 0.1 mL

LGALS3 (Carbohydrate-binding Protein 35, CBP35, GAL3, GALBP, GALIG, LGALS2, MAC2, Galectin 3) (PE)

Sign In for Pricing
View Details
LGALS3 (Carbohydrate-binding Protein 35, CBP35, GAL3, GALBP, GALIG, LGALS2, MAC2, Galectin 3) (PE)
MBS6424647-02 5x 0.1 mL

LGALS3 (Carbohydrate-binding Protein 35, CBP35, GAL3, GALBP, GALIG, LGALS2, MAC2, Galectin 3) (PE)

Sign In for Pricing
View Details
Horse Interleukin 18 ELISA Kit
IHSIL18KT 1 Each

Horse Interleukin 18 ELISA Kit

Sign In for Pricing
View Details
Human 2-oxoglutarate receptor 1, OXGR1 ELISA Kit
MBS9317866-01 48 Well

Human 2-oxoglutarate receptor 1, OXGR1 ELISA Kit

Sign In for Pricing
View Details
Human 2-oxoglutarate receptor 1, OXGR1 ELISA Kit
MBS9317866-02 96 Well

Human 2-oxoglutarate receptor 1, OXGR1 ELISA Kit

Sign In for Pricing
View Details
Human 2-oxoglutarate receptor 1, OXGR1 ELISA Kit
MBS9317866-03 5x 96 Well

Human 2-oxoglutarate receptor 1, OXGR1 ELISA Kit

Sign In for Pricing
View Details