Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli MRJP1 protein

This E.coli MRJP1 protein spans the amino acid sequence from region 20-432aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MRJP1

UniProt

O18330

Expression Region

20-432aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Apis mellifera (Honeybee)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCENPDNDRTPFKISIHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCR3, NT, Control Peptide (CD193, CC Chemokine Receptor Type 3, CC CKR 3, CC CKR3, B Chemokine Receptor, CMKBR3, Eosinophil CC Chemokine Receptor 3, Eosinophil Eotaxin Receptor, MGC102841)
C2099-67G1 50 µg

CCR3, NT, Control Peptide (CD193, CC Chemokine Receptor Type 3, CC CKR 3, CC CKR3, B Chemokine Receptor, CMKBR3, Eosinophil CC Chemokine Receptor 3, Eosinophil Eotaxin Receptor, MGC102841)

Sign In for Pricing
View Details
Streptavidin Magnetic Beads
S1420S 5 mL

Streptavidin Magnetic Beads

Sign In for Pricing
View Details
Mouse RING-box protein 2 ELISA Kit
MBS2888187-01 48 Well

Mouse RING-box protein 2 ELISA Kit

Sign In for Pricing
View Details
Mouse RING-box protein 2 ELISA Kit
MBS2888187-02 96 Well

Mouse RING-box protein 2 ELISA Kit

Sign In for Pricing
View Details
Mouse RING-box protein 2 ELISA Kit
MBS2888187-03 5x 96 Well

Mouse RING-box protein 2 ELISA Kit

Sign In for Pricing
View Details
Mouse RING-box protein 2 ELISA Kit
MBS2888187-04 10x 96 Well

Mouse RING-box protein 2 ELISA Kit

Sign In for Pricing
View Details