Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Gcgr protein

This Mouse Gcgr protein spans the amino acid sequence from region 27-143aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gcgr

UniProt

Q61606

Expression Region

27-143aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics, GPCR, Neuroscience, Signaling Pathways

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular domain of GST-tag and expression region is 27-143aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQPWRNASQCQLDDEEIEVQKGVAKMYSSQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC7A Antibody
MBS9612487-01 0.1 mL

TTC7A Antibody

Sign In for Pricing
View Details
TTC7A Antibody
MBS9612487-02 0.2 mL

TTC7A Antibody

Sign In for Pricing
View Details
TTC7A Antibody
MBS9612487-03 5x 0.2 mL

TTC7A Antibody

Sign In for Pricing
View Details
Lentiviral human PLAA sgRNA gene knockout kit - Lentiviral human PLAA sgRNA gene knockout kit (25)
GTR15356160 1 Vial

Lentiviral human PLAA sgRNA gene knockout kit - Lentiviral human PLAA sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
BT142 mut/- Cells
T1128 1x106 cells / 1.0 mL

BT142 mut/- Cells

Sign In for Pricing
View Details
Kv4.2 Rabbit pAb, Pacific Blue conjugated
orb2826006 100 µL

Kv4.2 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details