Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli yoaJ protein

This E.coli yoaJ protein spans the amino acid sequence from region 26-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YoaJ

UniProt

O34918

Expression Region

26-232aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bacillus subtilis (strain 168)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRASLS2 Polyclonal Antibody
orb1417276 100 µL

HRASLS2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rhodopsin (RHO)
TRV-0051990-01 10 µg

Recombinant Rhodopsin (RHO)

Sign In for Pricing
View Details
Recombinant Rhodopsin (RHO)
TRV-0051990-02 50 µg

Recombinant Rhodopsin (RHO)

Sign In for Pricing
View Details
Recombinant Rhodopsin (RHO)
TRV-0051990-03 100 µg

Recombinant Rhodopsin (RHO)

Sign In for Pricing
View Details
Recombinant Rhodopsin (RHO)
TRV-0051990-04 200 µg

Recombinant Rhodopsin (RHO)

Sign In for Pricing
View Details
Recombinant Rhodopsin (RHO)
TRV-0051990-05 500 µg

Recombinant Rhodopsin (RHO)

Sign In for Pricing
View Details