Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GADD45A protein

This Human GADD45A protein spans the amino acid sequence from region 1-165aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GADD45A

UniProt

P24522

Expression Region

1-165aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-165aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCKAP5 (NM_207481) Human Mass Spec Standard
PH321272 10 µg

NCKAP5 (NM_207481) Human Mass Spec Standard

Sign In for Pricing
View Details
INOS Rabbit Monoclonal Antibody
AG4771 50 µL

INOS Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human Receptor Ⅲ for the Fc region of immunoglobulin G (FcγRⅢ) ELISA Kit
GA-E0306HM-01 48 Tests

Human Receptor Ⅲ for the Fc region of immunoglobulin G (FcγRⅢ) ELISA Kit

Sign In for Pricing
View Details
Human Receptor Ⅲ for the Fc region of immunoglobulin G (FcγRⅢ) ELISA Kit
GA-E0306HM-02 96 Tests

Human Receptor Ⅲ for the Fc region of immunoglobulin G (FcγRⅢ) ELISA Kit

Sign In for Pricing
View Details
Cbfa2t2 (NM_172860) Mouse Tagged Lenti ORF Clone
MR217082L4 10 µg

Cbfa2t2 (NM_172860) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CD239 (Lutheran glycoprotein, Lu gp, B-CAM) (MaxLight 750) discontinued
C2548-98Q-ML750 100 µL

CD239 (Lutheran glycoprotein, Lu gp, B-CAM) (MaxLight 750) discontinued

Sign In for Pricing
View Details