Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FSHR protein

This Human FSHR protein spans the amino acid sequence from region 18-366aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FSHR

UniProt

P23945

Expression Region

18-366aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular domain of His-tag and expression region is 18-366AA

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Albumin, Pigeon Serum (Alb) (HRP)
MBS6002341-01 0.1 mg

Albumin, Pigeon Serum (Alb) (HRP)

Sign In for Pricing
View Details
Albumin, Pigeon Serum (Alb) (HRP)
MBS6002341-02 5x 0.1 mg

Albumin, Pigeon Serum (Alb) (HRP)

Sign In for Pricing
View Details
Nori® Mouse SOST ELISA Kit
GR117461 96 Well

Nori® Mouse SOST ELISA Kit

Sign In for Pricing
View Details
Anti-Bub1 AAMP Antibody Picoband® (APC Conjugate)
PB9135-APC 100 µg/Vial

Anti-Bub1 AAMP Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details
Ccdc108 sgRNA CRISPR Lentivector set (Mouse)
K3604001 3x 1.0 µg

Ccdc108 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
TIA1 Rabbit pAb
MBS8545963-01 0.1 mL

TIA1 Rabbit pAb

Sign In for Pricing
View Details