Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FSHR protein

This Human FSHR protein spans the amino acid sequence from region 18-366aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FSHR

UniProt

P23945

Expression Region

18-366aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular domain of His-tag and expression region is 18-366AA

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL36A antibody
70R-15125 100 ug

RPL36A antibody

Sign In for Pricing
View Details
Recombinant Polynucleobacter necessarius Ribonuclease HII (rnhB)
MBS1050648-01 0.02 mg (E-Coli)

Recombinant Polynucleobacter necessarius Ribonuclease HII (rnhB)

Sign In for Pricing
View Details
Recombinant Polynucleobacter necessarius Ribonuclease HII (rnhB)
MBS1050648-02 0.1 mg (E-Coli)

Recombinant Polynucleobacter necessarius Ribonuclease HII (rnhB)

Sign In for Pricing
View Details
Recombinant Polynucleobacter necessarius Ribonuclease HII (rnhB)
MBS1050648-03 0.02 mg (Yeast)

Recombinant Polynucleobacter necessarius Ribonuclease HII (rnhB)

Sign In for Pricing
View Details
Recombinant Polynucleobacter necessarius Ribonuclease HII (rnhB)
MBS1050648-04 0.1 mg (Yeast)

Recombinant Polynucleobacter necessarius Ribonuclease HII (rnhB)

Sign In for Pricing
View Details
Recombinant Polynucleobacter necessarius Ribonuclease HII (rnhB)
MBS1050648-05 0.02 mg (Baculovirus)

Recombinant Polynucleobacter necessarius Ribonuclease HII (rnhB)

Sign In for Pricing
View Details