Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli NSP4 protein

This E.coli NSP4 protein spans the amino acid sequence from region 52-175aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NSP4

UniProt

P04512

Expression Region

52-175aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rotavirus A (strain RVA/SA11-Both/G3P5B[2]) (RV-A) (Simian Agent 11 (strain Both) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEWESGKNPYEPREVTAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LMOD1 Pre-designed siRNA Set A
SI008792A 1 Each

Human LMOD1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-BRAFV600E Antibody
orb1140245 0.1 mL

Anti-BRAFV600E Antibody

Sign In for Pricing
View Details
5' HEX / 3' BHQ-2®
FP-133-05 5 to 9 nmol

5' HEX / 3' BHQ-2®

Sign In for Pricing
View Details
Recombinant Human Synaptic vesicle glycoprotein 2C (SV2C), partial
CSB-MP022980HUd7-01 20 µg

Recombinant Human Synaptic vesicle glycoprotein 2C (SV2C), partial

Sign In for Pricing
View Details
Recombinant Human Synaptic vesicle glycoprotein 2C (SV2C), partial
CSB-MP022980HUd7-02 100 µg

Recombinant Human Synaptic vesicle glycoprotein 2C (SV2C), partial

Sign In for Pricing
View Details
Recombinant Human Synaptic vesicle glycoprotein 2C (SV2C), partial
CSB-MP022980HUd7-03 1 mg

Recombinant Human Synaptic vesicle glycoprotein 2C (SV2C), partial

Sign In for Pricing
View Details