Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli lolA protein

This E. coli lolA protein spans the amino acid sequence from region 22-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LolA

UniProt

A7ZYJ5

Expression Region

22-203aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli O9:H4 (strain HS)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TXNDC11 shRNA (UAS) - Lentiviral human TXNDC11 shRNA (UAS) (100)
GTR15078678 1 Vial

Lentiviral human TXNDC11 shRNA (UAS) - Lentiviral human TXNDC11 shRNA (UAS) (100)

Sign In for Pricing
View Details
NF-KB p100 Rabbit mAb
MBS8603136-01 0.1 mL

NF-KB p100 Rabbit mAb

Sign In for Pricing
View Details
NF-KB p100 Rabbit mAb
MBS8603136-02 0.1 mL (AF405L)

NF-KB p100 Rabbit mAb

Sign In for Pricing
View Details
NF-KB p100 Rabbit mAb
MBS8603136-03 0.1 mL (AF405S)

NF-KB p100 Rabbit mAb

Sign In for Pricing
View Details
NF-KB p100 Rabbit mAb
MBS8603136-04 0.1 mL (AF610)

NF-KB p100 Rabbit mAb

Sign In for Pricing
View Details
NF-KB p100 Rabbit mAb
MBS8603136-05 0.1 mL (AF635)

NF-KB p100 Rabbit mAb

Sign In for Pricing
View Details