Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fgf1 protein

This Mouse Fgf1 protein spans the amino acid sequence from region 16-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fgf1 Fgf-1 Fgfa

UniProt

P61148

Expression Region

16-155aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 16-155aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2,6,6-Tetramethylpiperidine 1-oxyl, free radical - free flowing milled solid
FT09614-01 0.1 Kg

2,2,6,6-Tetramethylpiperidine 1-oxyl, free radical - free flowing milled solid

Sign In for Pricing
View Details
2,2,6,6-Tetramethylpiperidine 1-oxyl, free radical - free flowing milled solid
FT09614-02 0.25 kg

2,2,6,6-Tetramethylpiperidine 1-oxyl, free radical - free flowing milled solid

Sign In for Pricing
View Details
2,2,6,6-Tetramethylpiperidine 1-oxyl, free radical - free flowing milled solid
FT09614-03 0.5 Kg

2,2,6,6-Tetramethylpiperidine 1-oxyl, free radical - free flowing milled solid

Sign In for Pricing
View Details
2,2,6,6-Tetramethylpiperidine 1-oxyl, free radical - free flowing milled solid
FT09614-04 1 Kg

2,2,6,6-Tetramethylpiperidine 1-oxyl, free radical - free flowing milled solid

Sign In for Pricing
View Details
2,2,6,6-Tetramethylpiperidine 1-oxyl, free radical - free flowing milled solid
FT09614-05 2 Kg

2,2,6,6-Tetramethylpiperidine 1-oxyl, free radical - free flowing milled solid

Sign In for Pricing
View Details
NUDCD3 Rabbit Polyclonal Antibody (Biotin)
orb2586470 100 µg

NUDCD3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details