Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF1 protein

This Human FGF1 protein spans the amino acid sequence from region 16-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF1

UniProt

P05230

Expression Region

16-155aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 16-155aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FHOD1 Antibody
A72026-100UG 100 µg

FHOD1 Antibody

Sign In for Pricing
View Details
Ifitm7 sgRNA CRISPR Lentivector set (Mouse)
K3308801 3x 1.0 µg

Ifitm7 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Human Elongation factor 1-alpha 1 (EEF1A1) (K313R)
orb3155795-01 20 µg

Recombinant Human Elongation factor 1-alpha 1 (EEF1A1) (K313R)

Sign In for Pricing
View Details
Recombinant Human Elongation factor 1-alpha 1 (EEF1A1) (K313R)
orb3155795-02 100 µg

Recombinant Human Elongation factor 1-alpha 1 (EEF1A1) (K313R)

Sign In for Pricing
View Details
Recombinant Human Elongation factor 1-alpha 1 (EEF1A1) (K313R)
orb3155795-03 1 mg

Recombinant Human Elongation factor 1-alpha 1 (EEF1A1) (K313R)

Sign In for Pricing
View Details
OR7E59P Protein Lysate (Human) with C-Ha Tag
35620031 100 µg

OR7E59P Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details