Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF1 protein

This Human FGF1 protein spans the amino acid sequence from region 16-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF1

UniProt

P05230

Expression Region

16-155aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 16-155aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Styrene Oxide
OR1078818-01 25 mL

Styrene Oxide

Sign In for Pricing
View Details
Styrene Oxide
OR1078818-02 500 mL

Styrene Oxide

Sign In for Pricing
View Details
oligophrenin-1 CRISPR/Cas9 KO Plasmid (m)
sc-430125 20 µg

oligophrenin-1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Trim67 AAV siRNA Pooled Vector
47837166 1.0 µg

Trim67 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Sdz 204-090
T34591-01 100 mg

Sdz 204-090

Sign In for Pricing
View Details
Sdz 204-090
T34591-02 500 mg

Sdz 204-090

Sign In for Pricing
View Details