Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FCER2 protein

This Human FCER2 protein spans the amino acid sequence from region 48-321aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FCER2

UniProt

P06734

Expression Region

48-321aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Extracellular of His-SUMO-tag and expression region is 48-321aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Msi2 shRNA (UAS) - Lentiviral mouse Msi2 shRNA (UAS, GFP) plasmid
GTR15140422 1 Vial

Lentiviral mouse Msi2 shRNA (UAS) - Lentiviral mouse Msi2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
1,2-Dipalmitoyl-sn-glycerol (Standard)
HY-W010736R 1 Each

1,2-Dipalmitoyl-sn-glycerol (Standard)

Sign In for Pricing
View Details
Polyclonal Anti-EDNR-B Antibody
GWB-BBP052 0.1 mg

Polyclonal Anti-EDNR-B Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Axl [p Tyr779] Antibody (713610) [DyLight 488]
FAB6965K 0.1 mL

Mouse Monoclonal Axl [p Tyr779] Antibody (713610) [DyLight 488]

Sign In for Pricing
View Details
Rabbit Polyclonal Complement C7 Antibody [HRP]
NBP3-00202H 0.1 mL

Rabbit Polyclonal Complement C7 Antibody [HRP]

Sign In for Pricing
View Details
Anti-TCFL4 Antibody
MBS821973-01 0.03 mL

Anti-TCFL4 Antibody

Sign In for Pricing
View Details